Caspase 3 anticorps (AA 183-277) (Biotin)

N° du produit ABIN1173315

Cet anticorps anti-Caspase 3 est un anticorps Lapin Polyclonal détectant Caspase 3 dans WB, IHC et ICC. Adapté pour Humain.

Aperçu rapide pour Caspase 3 anticorps (AA 183-277) (Biotin) (ABIN1173315)

Antigène: Caspase 3 (CASP3)

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Caspase 3 est conjugé à/à la Biotin

Application: Western Blotting (WB), Immunohistochemistry (IHC), Immunocytochemistry (ICC)

Détail du produit anti-Caspase 3 anticorps (Biotin)

Épitope: AA 183-277

Fonction: Biotin-Linked Polyclonal Antibody to Caspase 3 (CASP3)

Séquence: MGSSHHHHHHSSGLVPRGSHMASMTGGQQMGRGSEF- ACHKIPVE ADFLYAYSTA PGYYSWRNSK DGSWFIQSLC AMLKQYADKL EFMHILTRVN RKVATEFESF SFDATFHAKK QIPCIVSMLT KELYFYH

Specificité: The antibody is a rabbit polyclonal antibody raised against CASP3. It has been selected for its ability to recognize CASP3 in immunohistochemical staining and western blotting.

Réactivité croisée: Souris, Rat

Purification: Antigen-specific affinity chromatography followed by Protein A affinity chromatography

Immunogène: Recombinant CASP3 expressed in E.coli.
The antibody is a rabbit polyclonal antibody raised against CASP3 conjugated to biotin.

Isotype: IgG

Information d'application

Indications d'application: Western blotting: 0.2-2 μg/mL,1:250-2500 Immunohistochemistry: 5-20 μg/mL,1:25-100 Immunocytochemistry: 5-20 μg/mL,1:25-100 Optimal working dilutions must be determined by end user.

Commentaires:

The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37°C for 48h, and no obvious degradation and precipitation were observed. The loss rate is less than 5% within the expiration date under appropriate storage condition.

Restrictions: For Research Use only

Stockage

Format: Liquid

Concentration: 500 μg/mL

Buffer: PBS, pH 7.4, containing 0.02 % Sodium azide, 50 % glycerol.

Agent conservateur: Sodium azide

Précaution d'utilisation: WARNING: Reagents contain sodium azide. Sodium azide is very toxic if ingested or inhaled. Avoid contact with skin, eyes, or clothing. Wear eye or face protection when handling. If skin or eye contact occurs, wash with copious amounts of water. If ingested or inhaled, contact a physician immediately. Sodium azide yields toxic hydrazoic acid under acidic conditions. Dilute azide-containing compounds in running water before discarding to avoid accumulation of potentially explosive deposits in lead or copper plumbing.

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles

Stock: 4 °C,-20 °C

Stockage commentaire: Store at 4°C for frequent use. Stored at -20°C in a manual defrost freezer for two year without detectable loss of activity. Avoid repeated freeze-thaw cycles.

Date de péremption: 12 months

Détails sur Caspase 3

Antigène: Caspase 3 (CASP3)

Autre désignation: Caspase 3

Sujet: CPP32, CPP32B, SCA1, Apoptain, Yama, Apoptosis-Related Cysteine Peptidase, Cysteinyl Aspartate Specific Proteinases 3, SREBP cleavage activity 1

Pathways: Apoptose, Caspase Cascade in Apoptosis, Sensory Perception of Sound, ER-Nucleus Signaling, Positive Regulation of Endopeptidase Activity, Activated T Cell Proliferation